What does ACE-031 do?

ACE-031 is described as an investigational ACVR2B-Fc fusion protein intended to reduce signaling from myostatin and related growth-limiting ligands. It was studied for muscle-related outcomes, including Duchenne muscular dystrophy research, but development was stopped and it is not an approved product.

How does ACE-031 work?

ACE-031 acts as a soluble decoy receptor based on activin receptor type IIB. By binding myostatin and related TGF-beta family ligands in circulation, it was designed to reduce their access to cell-surface receptors involved in limiting muscle growth. The same signaling network is also relevant outside muscle, which may help explain vascular and bleeding-related safety signals noted in trials.

Is ACE-031 FDA approved?

No. The source lists ACE-031 as not FDA approved and describes its development as halted because of safety concerns.

What side effects were reported for ACE-031?

The source reports nosebleeds, gum bleeding, telangiectasias, injection-site reactions and decreased FSH levels. It also notes that clinical development was discontinued after safety concerns emerged.

What dose information is available for ACE-031?

The source does not provide a reliable community dose beyond noting limited community data. In research settings, it reports 0.5-3 mg/kg every 2 weeks by subcutaneous injection in trials that were later discontinued.

Hormonalne Badania kliniczne - trwają badania u ludzi

ACE-031

Znany też jako: ACVR2B-Fc, Myostatin Inhibitor

W skrócie

Zbiór danych PeptiGuide · przegląd sie 2026

Czym jest

Investigational ACVR2B-Fc myostatin-pathway inhibitor discontinued after safety concerns.

Status

Badania kliniczne

Poziom dowodów: badania z udziałem ludzi

Typowa dawka

Limited community data available

Subcutaneous injection

Badany pod kątem

Muscle growth research, muscular dystrophy

Postęp badań

PrePrzedkliniczne
IFaza I
IIFaza II
IIIFaza III
IVFaza IV
FDAZatwierdzone przez FDA

Faza II - Wczesne dane u ludzi z istotnymi ograniczeniami

Użyj narzędzi

Prostym językiem

Investigational ACVR2B-Fc fusion protein studied for myostatin-pathway inhibition.
Researched for muscle growth and muscular dystrophy contexts, including Duchenne muscular dystrophy.
Not FDA approved; development is reported as halted after safety concerns.
Community dose information is limited, while research dosing came from discontinued trials.

Jak prawdopodobnie działa

ACE-031 is an ACVR2B-Fc fusion protein designed to function as a circulating ligand trap. The source describes it as binding myostatin and related TGF-beta superfamily ligands before they can signal through activin type IIB receptors on muscle. This pathway was investigated as a way to reduce growth-inhibitory signaling. Reported bleeding and telangiectasia findings are consistent with concern that activin-receptor signaling also affects vascular biology.

Co pokazują badania

Na jakim etapie są badania

The source describes ACE-031 as having been evaluated in humans, including single-ascending-dose work in healthy volunteers and an ascending-dose, placebo-controlled Phase 2 study in ambulatory boys with Duchenne muscular dystrophy. Reported study signals included changes related to lean mass, fat mass, bone measures and 6-minute walk distance. The Duchenne study stopped early after safety findings such as nosebleeds and telangiectasias, and the broader program was discontinued despite no serious or severe adverse events being formally attributed in the source summary.

Co pokazują

✓ Badania z udziałem ludzi

Wczesne dane u ludzi z istotnymi ograniczeniami

△ Ograniczenia

Protokoły badawcze opisują badania i nie są rekomendacjami dawkowania.

Podsumowanie: Development halted due to safety concerns Not FDA Approved

Typowe dawkowanie

SpołecznośćZbiór danych społeczności

Limited community data available

See research protocols

Zakres: See research dosing

Community dosing information in the source is sparse and points back to research protocols rather than a well-established community regimen.

Dawkowanie badawcze

Protokoły badawczeTrwają badania u ludzi - protokoły są specyficzne dla badań

Dawki obserwowane w badaniach

0.5-3 mg/kg every 2 weeks in trials

Research literature observed in studies

Protokoły badawcze opisują badania i nie są rekomendacjami dawkowania.

Czas trwania: Trials discontinued
Podanie: Subcutaneous injection
Częstotliwość: Every 2 weeks in trials

Timing i podanie

Najlepsza pora

Morning, same day each week

Once weekly

Zalecenia żywieniowe

With or without food

Dlaczego taki timing?

The source suggests a morning schedule to make observation after use more practical, with weekly timing noted separately from the every-2-week research dosing row.

Możliwe skutki uboczne

Nie każdy ich doświadcza. Indywidualne reakcje zależą od dawki, czasu trwania i czynników osobistych.

Nosebleeds
Gum bleeding
Spider veins (telangiectasias)
Injection-site reactions
FSH level decrease
Clinical trials discontinued due to safety concerns

Nie każdy doświadcza skutków ubocznych, a nasilenie może zależeć od kontekstu, czystości, drogi podania i indywidualnych czynników zdrowotnych.

Źródła

PubMed ClinicalTrials.gov FDA.gov

Najczęstsze pytania

Sekwencja

GRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK; ACVR2B-Fc dimer with KEGG-defined inter/intrachain disulfides and glycosylation sites

Jeden otwarty zbiór danych

Każdy fakt na tej stronie - dawki, skutki uboczne, referencje - pochodzi z tego samego zbioru danych PeptiGuide, który zasila Tracker, Porównywarkę i Lab.

Przeglądaj zbiór danych

Zapisz na mojej liście Aktualizacje o ACE‑031

Materiał edukacyjny, nie porada medyczna. Porozmawiaj z lekarzem, zanim podejmiesz działania.

Dyskusja społeczności

Komentarze są moderowane przed publikacją. Trzymajmy się dowodów.

ACE-031

Prostym językiemProstym językiem

Jak prawdopodobnie działaJak prawdopodobnie działa

Co pokazują badaniaCo pokazują badania

Typowe dawkowanie

Dawkowanie badawcze

Timing i podanieTiming i podanie

Możliwe skutki uboczneMożliwe skutki uboczne

ŹródłaŹródła

Najczęstsze pytaniaNajczęstsze pytania