Pegvisomant
Also known as: Somavert
At a glance
PeptiGuide dataset · reviewed Aug 2026
What it is
PEGylated growth hormone receptor antagonist researched for acromegaly and IGF-1 control.
Status
FDA Approved
Typical dose
10–30mg
Researched for
Acromegaly, GH blockade, IGF-1 normalization
Trial progress
- PrePreclinical
- IPhase I
- IIPhase II
- IIIPhase III
- IVPhase IV
- FDAFDA approved
FDA approved - FDA-approved for specific uses with established human evidence
Use the tools
Stay current
Get updates on Pegvisomant
New studies, regulatory decisions and data corrections - delivered when they land.
In plain language
Pegvisomant is a single entry with Somavert listed as an alias. It is described as a PEGylated modified human growth hormone analog that antagonizes the growth hormone receptor. The source lists FDA approval for acromegaly, once-daily administration, and research interest in acromegaly, growth hormone blockade, and IGF-1 normalization.
How it's thought to work
Pegvisomant is described as a PEGylated, genetically modified human growth hormone analog that functions as a growth hormone receptor antagonist. It can bind receptor sites without allowing the receptor complex to signal normally, which reduces downstream IGF-1 production. The source also notes that this receptor-level action does not directly lower pituitary growth hormone output or shrink a pituitary tumor, so growth hormone laboratory values and imaging follow-up may need separate interpretation.
What the research shows
Where the research stands
The source describes Pegvisomant as having randomized human trial evidence, including a 12-week New England Journal of Medicine study by Trainer and colleagues in 2000 that reported dose-related IGF-1 reductions and higher normalization at the top studied dose than placebo. It also cites longer-term observational experience and ACROSTUDY surveillance as supporting IGF-1 control in many adequately dosed patients. Key uncertainties and monitoring issues noted by the source include liver enzyme elevations and the fact that receptor blockade does not itself manage tumor size.
What it shows
✓ Human clinical evidence
FDA-approved for specific uses with established human evidence
△ Limitations
Use only according to approved labeling and qualified medical guidance.
Bottom line: FDA approved for acromegaly FDA Approved
Typical dosing
CommunityCommunity dataset10–30 mg
daily
Reported as a community dosing entry for acromegaly-related growth hormone receptor antagonism. The source also notes prescription-only status and liver function monitoring. · Subcutaneous injection daily
Research dosing
Indication-specificApproved for specific uses - study doses are indication-specific
Timing & administration
Best time to take
Morning or as directed
Follow recommended protocol
Food recommendation
With or without food
Why this timing?
The source does not establish a single evidence-based clock time. It indicates that consistent timing may matter more than whether administration occurs at a specific time of day.
Possible side effects
Not everyone experiences these. Individual responses vary with dose, duration, and personal factors.
- Infection
- Pain
- Nausea
- Injection site reactions
- Liver toxicity
- Hypoglycemia in diabetics
Not everyone experiences side effects, and severity can vary by context, purity, route, and individual health factors.
Sources
Frequently asked questions
Sequence
FPTIPLSRLFDNAMLRADRLNQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEKIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFNADMSRVSTFLRTVQCRSVEGSCGF; PEGylated GH analogue
One open dataset
Every fact on this page - doses, side effects, references - comes from the same PeptiGuide dataset that powers the Tracker, Compare, and the Lab.
Browse the datasetEducational resource, not medical advice. Talk to your clinician before acting on anything here.
Community discussion
Comments are moderated before they appear. Keep it evidence-focused.