pepti

Search PeptiGuide

Popular searches

Pegvisomant

Also known as: Somavert

At a glance

PeptiGuide dataset · reviewed Aug 2026

What it is

PEGylated growth hormone receptor antagonist researched for acromegaly and IGF-1 control.

Status

FDA Approved

Typical dose

10–30mg

Researched for

Acromegaly, GH blockade, IGF-1 normalization

Trial progress

  1. PrePreclinical
  2. IPhase I
  3. IIPhase II
  4. IIIPhase III
  5. IVPhase IV
  6. FDAFDA approved

FDA approved - FDA-approved for specific uses with established human evidence

Stay current

Get updates on Pegvisomant

New studies, regulatory decisions and data corrections - delivered when they land.

Pegvisomant is a single entry with Somavert listed as an alias. It is described as a PEGylated modified human growth hormone analog that antagonizes the growth hormone receptor. The source lists FDA approval for acromegaly, once-daily administration, and research interest in acromegaly, growth hormone blockade, and IGF-1 normalization.

Pegvisomant is described as a PEGylated, genetically modified human growth hormone analog that functions as a growth hormone receptor antagonist. It can bind receptor sites without allowing the receptor complex to signal normally, which reduces downstream IGF-1 production. The source also notes that this receptor-level action does not directly lower pituitary growth hormone output or shrink a pituitary tumor, so growth hormone laboratory values and imaging follow-up may need separate interpretation.

Where the research stands

The source describes Pegvisomant as having randomized human trial evidence, including a 12-week New England Journal of Medicine study by Trainer and colleagues in 2000 that reported dose-related IGF-1 reductions and higher normalization at the top studied dose than placebo. It also cites longer-term observational experience and ACROSTUDY surveillance as supporting IGF-1 control in many adequately dosed patients. Key uncertainties and monitoring issues noted by the source include liver enzyme elevations and the fact that receptor blockade does not itself manage tumor size.

What it shows

Human clinical evidence

FDA-approved for specific uses with established human evidence

Limitations

Use only according to approved labeling and qualified medical guidance.

Bottom line: FDA approved for acromegaly FDA Approved

Typical dosing

Community

10–30 mg

daily

10 mg40 mg

Reported as a community dosing entry for acromegaly-related growth hormone receptor antagonism. The source also notes prescription-only status and liver function monitoring. · Subcutaneous injection daily

Research dosing

Indication-specific

Doses observed in studies

40 mg loading dose

FDA Approved Labeling - Prescribed dose

Use only according to approved labeling and qualified medical guidance.

Duration
Long-term / chronic use
Administration
Subcutaneous injection daily

Best time to take

Morning or as directed

Follow recommended protocol

Food recommendation

With or without food

Why this timing?

The source does not establish a single evidence-based clock time. It indicates that consistent timing may matter more than whether administration occurs at a specific time of day.

Not everyone experiences these. Individual responses vary with dose, duration, and personal factors.

  • Infection
  • Pain
  • Nausea
  • Injection site reactions
  • Liver toxicity
  • Hypoglycemia in diabetics

Not everyone experiences side effects, and severity can vary by context, purity, route, and individual health factors.

FPTIPLSRLFDNAMLRADRLNQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEKIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFNADMSRVSTFLRTVQCRSVEGSCGF; PEGylated GH analogue

One open dataset

Every fact on this page - doses, side effects, references - comes from the same PeptiGuide dataset that powers the Tracker, Compare, and the Lab.

Browse the dataset

Educational resource, not medical advice. Talk to your clinician before acting on anything here.

Community discussion

Comments are moderated before they appear. Keep it evidence-focused.