What does Pegvisomant do?

Pegvisomant is described as a PEGylated, engineered version of human growth hormone that blocks growth hormone receptors. The source frames it in the context of acromegaly, where receptor blockade is used to reduce downstream IGF-1 activity rather than suppressing pituitary growth hormone release directly.

How does Pegvisomant work?

The source describes Pegvisomant as binding the growth hormone receptor in a way that prevents productive receptor activation. By interrupting receptor signaling, it can reduce IGF-1 production in tissues such as the liver. Because the action is downstream of the pituitary, circulating growth hormone may not fall, and tumor size control is a separate monitoring issue.

Is Pegvisomant FDA approved?

Yes. The source lists Pegvisomant as FDA approved for acromegaly and identifies Somavert as the brand name.

What side effects are reported for Pegvisomant?

Reported effects in the source include infection, pain, nausea, injection site reactions, rare but serious liver toxicity, and hypoglycemia in diabetics. These are evidence-summary items and do not predict any individual response.

What typical dose is reported for Pegvisomant?

The source lists a community-reported common dose of 10-30 mg daily, a range of 10-40 mg daily, and daily subcutaneous administration. It also includes a research-label row with a 40 mg loading dose. These values are preserved as source-reported evidence, not personal dosing advice.

Hormonalne Zatwierdzone przez FDA - zatwierdzony w określonych wskazaniach

Pegvisomant

Znany też jako: Somavert

W skrócie

Zbiór danych PeptiGuide · przegląd sie 2026

Czym jest

PEGylated growth hormone receptor antagonist researched for acromegaly and IGF-1 control.

Status

Zatwierdzone przez FDA

Poziom dowodów: dane kliniczne u ludzi

Typowa dawka

10–30mg

Subcutaneous injection daily

Badany pod kątem

Acromegaly, GH blockade, IGF-1 normalization

Postęp badań

PrePrzedkliniczne
IFaza I
IIFaza II
IIIFaza III
IVFaza IV
FDAZatwierdzone przez FDA

Zatwierdzone przez FDA - Zatwierdzone zastosowania z ustalonymi danymi u ludzi

Użyj narzędzi

Prostym językiem

Pegvisomant is a single peptide entry with Somavert listed as an alias. It is described as a PEGylated modified human growth hormone analog that antagonizes the growth hormone receptor. The source lists FDA approval for acromegaly, once-daily subcutaneous administration, and research interest in acromegaly, growth hormone blockade, and IGF-1 normalization.

Jak prawdopodobnie działa

Pegvisomant is described as a PEGylated, genetically modified human growth hormone analog that functions as a growth hormone receptor antagonist. It can bind receptor sites without allowing the receptor complex to signal normally, which reduces downstream IGF-1 production. The source also notes that this receptor-level action does not directly lower pituitary growth hormone output or shrink a pituitary tumor, so growth hormone laboratory values and imaging follow-up may need separate interpretation.

Co pokazują badania

Na jakim etapie są badania

The source describes Pegvisomant as having randomized human trial evidence, including a 12-week New England Journal of Medicine study by Trainer and colleagues in 2000 that reported dose-related IGF-1 reductions and higher normalization at the top studied dose than placebo. It also cites longer-term observational experience and ACROSTUDY surveillance as supporting IGF-1 control in many adequately dosed patients. Key uncertainties and monitoring issues noted by the source include liver enzyme elevations and the fact that receptor blockade does not itself manage tumor size.

Co pokazują

✓ Dane kliniczne u ludzi

Zatwierdzone zastosowania z ustalonymi danymi u ludzi

△ Ograniczenia

Stosowanie wyłącznie zgodnie z zatwierdzoną dokumentacją i pod opieką wykwalifikowanego specjalisty.

Podsumowanie: FDA approved for acromegaly FDA Approved

Typowe dawkowanie

SpołecznośćZbiór danych społeczności

10–30 mg

daily

10 mgpełny obserwowany zakres40 mg

Reported as a community dosing entry for acromegaly-related growth hormone receptor antagonism. The source also notes prescription-only status and liver function monitoring. · Subcutaneous injection daily

Dawkowanie badawcze

Zależne od wskazaniaZatwierdzony w określonych wskazaniach - dawki z badań zależą od wskazania

Dawki obserwowane w badaniach

40 mg loading dose

FDA Approved Labeling - Prescribed dose

Stosowanie wyłącznie zgodnie z zatwierdzoną dokumentacją i pod opieką wykwalifikowanego specjalisty.

Czas trwania: Long-term / chronic use
Podanie: Subcutaneous injection daily

Timing i podanie

Najlepsza pora

Morning or as directed

Follow recommended protocol

Zalecenia żywieniowe

With or without food

Dlaczego taki timing?

The source does not establish a single evidence-based clock time. It indicates that consistent timing may matter more than whether administration occurs at a specific time of day.

Możliwe skutki uboczne

Nie każdy ich doświadcza. Indywidualne reakcje zależą od dawki, czasu trwania i czynników osobistych.

Infection
Pain
Nausea
Injection site reactions
Liver toxicity
Hypoglycemia in diabetics

Nie każdy doświadcza skutków ubocznych, a nasilenie może zależeć od kontekstu, czystości, drogi podania i indywidualnych czynników zdrowotnych.

Źródła

PubMed ClinicalTrials.gov FDA.gov

Najczęstsze pytania

Sekwencja

FPTIPLSRLFDNAMLRADRLNQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEKIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFNADMSRVSTFLRTVQCRSVEGSCGF; PEGylated GH analogue

Jeden otwarty zbiór danych

Każdy fakt na tej stronie - dawki, skutki uboczne, referencje - pochodzi z tego samego zbioru danych PeptiGuide, który zasila Tracker, Porównywarkę i Lab.

Przeglądaj zbiór danych

Zapisz na mojej liście Aktualizacje o Pegvisomant

Materiał edukacyjny, nie porada medyczna. Porozmawiaj z lekarzem, zanim podejmiesz działania.

Dyskusja społeczności

Komentarze są moderowane przed publikacją. Trzymajmy się dowodów.

Pegvisomant

Prostym językiemProstym językiem

Jak prawdopodobnie działaJak prawdopodobnie działa

Co pokazują badaniaCo pokazują badania

Typowe dawkowanie

Dawkowanie badawcze

Timing i podanieTiming i podanie

Możliwe skutki uboczneMożliwe skutki uboczne

ŹródłaŹródła

Najczęstsze pytaniaNajczęstsze pytania