Cagrilintide
Also known as: AM833, NN9838, CagriSema (combination)
At a glance
PeptiGuide dataset · reviewed Aug 2026
What it is
Investigational weekly amylin analog studied for weight management and CagriSema combination therapy.
Status
Clinical Trials
Typical dose
2.4mg
Researched for
Weight loss, appetite control, combination therapy
Trial progress
- PrePreclinical
- IPhase I
- IIPhase II
- IIIPhase III
- IVPhase IV
- FDAFDA approved
Phase III - Emerging human evidence with important limitations
Use the tools
Stay current
Get updates on Cagrilintide
New studies, regulatory decisions and data corrections - delivered when they land.
In plain language
- Investigational long-acting amylin analog also called AM833.
- Studied for weight loss, appetite control, and combination use with semaglutide as CagriSema.
- Source reports phase 3 development and no standalone FDA approval.
- Reported administration is once-weekly injection, with 2.4 mg weekly listed as a typical source-reported dose.
- Human trial evidence is reported, but approval, final labeling, and long-term safety remain under review.
How it's thought to work
Cagrilintide is described as a long-acting amylin analog with activity across the amylin and calcitonin receptor family. The source reports signaling through amylin receptor complexes, including receptors formed by calcitonin receptors with RAMP proteins. Reported downstream effects include central satiety signaling, delayed gastric emptying, and moderation of meal-related glucagon increases. Mechanistic animal data in the source emphasize AMY1R and AMY3R pathways involving hindbrain regions such as the area postrema, nucleus of the solitary tract, and parabrachial nucleus. The molecule is described as a modified pramlintide-like 37-amino-acid analog with a fatty-diacid modification intended to extend exposure to about one week.
What the research shows
Where the research stands
The supplied source describes cagrilintide as having controlled human evidence, including a 2021 phase 2 dose-finding trial in which once-weekly 4.5 mg cagrilintide was associated with about 10.8% mean body-weight loss over 26 weeks, compared with roughly 3% for placebo and about 9% for liraglutide 3.0 mg. The source also highlights phase 3 REDEFINE development for CagriSema in obesity and type 2 diabetes, with weight-loss results reported in the low-20% range for the combination. Gastrointestinal tolerability issues, especially nausea and vomiting, are described as prominent. As presented by the source, cagrilintide remains investigational rather than an approved standalone therapy.
What it shows
✓ Human studies
Emerging human evidence with important limitations
△ Limitations
Study protocols describe research and are not dosing recommendations.
Bottom line: Investigational phase 3 program, mainly through CagriSema; source reports an NDA submitted in Dec 2025 with FDA decision expected in Q4 2026. Not FDA Approved
Typical dosing
CommunityCommunity dataset2.4 mg
weekly
Community-reported dosing describes weekly escalation and notes that cagrilintide remains investigational. This is not a treatment recommendation.
Research dosing
Study-specific protocolsHuman trials under way - protocols are study-specific
Timing & administration
Best time to take
Any consistent time weekly
Once weekly
Food recommendation
With or without food
Why this timing?
The source links weekly use to prolonged amylin receptor activity; keeping the schedule consistent is the reported timing principle.
Possible side effects
Not everyone experiences these. Individual responses vary with dose, duration, and personal factors.
- Nausea
- Vomiting
- Diarrhea
- Constipation
- Abdominal pain
- Injection site reactions
- Decreased appetite
- Headache
- Dyspepsia
- Gastrointestinal events in CagriSema trials
- Limited long-term safety data
Not everyone experiences side effects, and severity can vary by context, purity, route, and individual health factors.
Sources
Frequently asked questions
Sequence
C20-diacid-gamma-Glu-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2; Cys2-Cys7 disulfide
One open dataset
Every fact on this page - doses, side effects, references - comes from the same PeptiGuide dataset that powers the Tracker, Compare, and the Lab.
Browse the datasetEducational resource, not medical advice. Talk to your clinician before acting on anything here.
Community discussion
Comments are moderated before they appear. Keep it evidence-focused.