pepti

Search PeptiGuide

Popular searches

Cagrilintide

Also known as: AM833, NN9838, CagriSema (combination)

At a glance

PeptiGuide dataset · reviewed Aug 2026

What it is

Investigational weekly amylin analog studied for weight management and CagriSema combination therapy.

Status

Clinical Trials

Typical dose

2.4mg

Researched for

Weight loss, appetite control, combination therapy

Trial progress

  1. PrePreclinical
  2. IPhase I
  3. IIPhase II
  4. IIIPhase III
  5. IVPhase IV
  6. FDAFDA approved

Phase III - Emerging human evidence with important limitations

Stay current

Get updates on Cagrilintide

New studies, regulatory decisions and data corrections - delivered when they land.

  • Investigational long-acting amylin analog also called AM833.
  • Studied for weight loss, appetite control, and combination use with semaglutide as CagriSema.
  • Source reports phase 3 development and no standalone FDA approval.
  • Reported administration is once-weekly injection, with 2.4 mg weekly listed as a typical source-reported dose.
  • Human trial evidence is reported, but approval, final labeling, and long-term safety remain under review.

Cagrilintide is described as a long-acting amylin analog with activity across the amylin and calcitonin receptor family. The source reports signaling through amylin receptor complexes, including receptors formed by calcitonin receptors with RAMP proteins. Reported downstream effects include central satiety signaling, delayed gastric emptying, and moderation of meal-related glucagon increases. Mechanistic animal data in the source emphasize AMY1R and AMY3R pathways involving hindbrain regions such as the area postrema, nucleus of the solitary tract, and parabrachial nucleus. The molecule is described as a modified pramlintide-like 37-amino-acid analog with a fatty-diacid modification intended to extend exposure to about one week.

Where the research stands

The supplied source describes cagrilintide as having controlled human evidence, including a 2021 phase 2 dose-finding trial in which once-weekly 4.5 mg cagrilintide was associated with about 10.8% mean body-weight loss over 26 weeks, compared with roughly 3% for placebo and about 9% for liraglutide 3.0 mg. The source also highlights phase 3 REDEFINE development for CagriSema in obesity and type 2 diabetes, with weight-loss results reported in the low-20% range for the combination. Gastrointestinal tolerability issues, especially nausea and vomiting, are described as prominent. As presented by the source, cagrilintide remains investigational rather than an approved standalone therapy.

What it shows

Human studies

Emerging human evidence with important limitations

Limitations

Study protocols describe research and are not dosing recommendations.

Bottom line: Investigational phase 3 program, mainly through CagriSema; source reports an NDA submitted in Dec 2025 with FDA decision expected in Q4 2026. Not FDA Approved

Typical dosing

Community

2.4 mg

weekly

1 mg2.4 mg

Community-reported dosing describes weekly escalation and notes that cagrilintide remains investigational. This is not a treatment recommendation.

Research dosing

Study-specific protocols

Doses observed in studies

2.4 mg weekly

REDEFINE 1 Trial - Phase 3

Study protocols describe research and are not dosing recommendations.

Duration
Long-term / chronic use expected
Administration
Subcutaneous injection once weekly
Frequency
Once weekly

Best time to take

Any consistent time weekly

Once weekly

Food recommendation

With or without food

Why this timing?

The source links weekly use to prolonged amylin receptor activity; keeping the schedule consistent is the reported timing principle.

Not everyone experiences these. Individual responses vary with dose, duration, and personal factors.

  • Nausea
  • Vomiting
  • Diarrhea
  • Constipation
  • Abdominal pain
  • Injection site reactions
  • Decreased appetite
  • Headache
  • Dyspepsia
  • Gastrointestinal events in CagriSema trials
  • Limited long-term safety data

Not everyone experiences side effects, and severity can vary by context, purity, route, and individual health factors.

C20-diacid-gamma-Glu-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2; Cys2-Cys7 disulfide

One open dataset

Every fact on this page - doses, side effects, references - comes from the same PeptiGuide dataset that powers the Tracker, Compare, and the Lab.

Browse the dataset

Educational resource, not medical advice. Talk to your clinician before acting on anything here.

Community discussion

Comments are moderated before they appear. Keep it evidence-focused.