Cagrilintide
Znany też jako: AM833, NN9838, CagriSema (combination)
W skrócie
Zbiór danych PeptiGuide · przegląd sie 2026
Czym jest
Investigational weekly amylin analog studied for weight management and CagriSema combination therapy.
Status
Badania kliniczne
Typowa dawka
2,4mg
Badany pod kątem
Weight loss, appetite control, combination therapy
Postęp badań
- PrePrzedkliniczne
- IFaza I
- IIFaza II
- IIIFaza III
- IVFaza IV
- FDAZatwierdzone przez FDA
Faza III - Wczesne dane u ludzi z istotnymi ograniczeniami
Użyj narzędzi
Bądź na bieżąco
Aktualizacje o Cagrilintide
Nowe badania, decyzje regulacyjne i korekty danych - gdy tylko się pojawią.
Prostym językiem
- Investigational long-acting amylin analog also called AM833.
- Studied for weight loss, appetite control, and combination use with semaglutide as CagriSema.
- Source reports phase 3 development and no standalone FDA approval.
- Reported administration is once-weekly subcutaneous injection, with 2.4 mg weekly listed as a typical source-reported dose.
- Human trial evidence is reported, but approval, final labeling, and long-term safety remain under review.
Jak prawdopodobnie działa
Cagrilintide is described as a long-acting amylin analog with activity across the amylin and calcitonin receptor family. The source reports signaling through amylin receptor complexes, including receptors formed by calcitonin receptors with RAMP proteins. Reported downstream effects include central satiety signaling, delayed gastric emptying, and moderation of meal-related glucagon increases. Mechanistic animal data in the source emphasize AMY1R and AMY3R pathways involving hindbrain regions such as the area postrema, nucleus of the solitary tract, and parabrachial nucleus. The molecule is described as a modified pramlintide-like 37-amino-acid analog with a fatty-diacid modification intended to extend exposure to about one week.
Co pokazują badania
Na jakim etapie są badania
The supplied source describes cagrilintide as having controlled human evidence, including a 2021 phase 2 dose-finding trial in which once-weekly 4.5 mg cagrilintide was associated with about 10.8% mean body-weight loss over 26 weeks, compared with roughly 3% for placebo and about 9% for liraglutide 3.0 mg. The source also highlights phase 3 REDEFINE development for CagriSema in obesity and type 2 diabetes, with weight-loss results reported in the low-20% range for the combination. Gastrointestinal tolerability issues, especially nausea and vomiting, are described as prominent. As presented by the source, cagrilintide remains investigational rather than an approved standalone therapy.
Co pokazują
✓ Badania z udziałem ludzi
Wczesne dane u ludzi z istotnymi ograniczeniami
△ Ograniczenia
Protokoły badawcze opisują badania i nie są rekomendacjami dawkowania.
Podsumowanie: Investigational phase 3 program, mainly through CagriSema; source reports an NDA submitted in Dec 2025 with FDA decision expected in Q4 2026. Not FDA Approved
Typowe dawkowanie
SpołecznośćZbiór danych społeczności2,4 mg
weekly
Community-reported dosing describes weekly escalation and notes that cagrilintide remains investigational. This is not a treatment recommendation.
Dawkowanie badawcze
Protokoły badawczeTrwają badania u ludzi - protokoły są specyficzne dla badań
Timing i podanie
Najlepsza pora
Any consistent time weekly
Once weekly
Zalecenia żywieniowe
With or without food
Dlaczego taki timing?
The source links weekly use to prolonged amylin receptor activity; keeping the schedule consistent is the reported timing principle.
Możliwe skutki uboczne
Nie każdy ich doświadcza. Indywidualne reakcje zależą od dawki, czasu trwania i czynników osobistych.
- Nausea
- Vomiting
- Diarrhea
- Constipation
- Abdominal pain
- Injection site reactions
- Decreased appetite
- Headache
- Dyspepsia
- Gastrointestinal events in CagriSema trials
- Limited long-term safety data
Nie każdy doświadcza skutków ubocznych, a nasilenie może zależeć od kontekstu, czystości, drogi podania i indywidualnych czynników zdrowotnych.
Źródła
Najczęstsze pytania
Sekwencja
C20-diacid-gamma-Glu-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2; Cys2-Cys7 disulfide
Jeden otwarty zbiór danych
Każdy fakt na tej stronie - dawki, skutki uboczne, referencje - pochodzi z tego samego zbioru danych PeptiGuide, który zasila Tracker, Porównywarkę i Lab.
Przeglądaj zbiór danychMateriał edukacyjny, nie porada medyczna. Porozmawiaj z lekarzem, zanim podejmiesz działania.
Dyskusja społeczności
Komentarze są moderowane przed publikacją. Trzymajmy się dowodów.