Dulaglutide
Znany też jako: Trulicity
W skrócie
Zbiór danych PeptiGuide · przegląd sie 2026
Czym jest
Once-weekly GLP-1 receptor agonist listed as FDA approved for type 2 diabetes.
Status
Zatwierdzone przez FDA
Typowa dawka
1,5–4,5mg
Badany pod kątem
Blood sugar control, weight management, diabetes
Postęp badań
- PrePrzedkliniczne
- IFaza I
- IIFaza II
- IIIFaza III
- IVFaza IV
- FDAZatwierdzone przez FDA
Zatwierdzone przez FDA - Zatwierdzone zastosowania z ustalonymi danymi u ludzi
Użyj narzędzi
Bądź na bieżąco
Aktualizacje o Dulaglutide
Nowe badania, decyzje regulacyjne i korekty danych - gdy tylko się pojawią.
Prostym językiem
- Dulaglutide, also called Trulicity, is described as a once-weekly injectable receptor agonist.
- Source status fields list FDA Approved, with clinical status for type 2 diabetes.
- The source also states FDA approval for cardiovascular risk reduction in adults with diabetes.
- Reported typical dose is 1.5-4.5 mg weekly, with subcutaneous weekly administration and a 0.75-4.5 mg weekly range.
- Source researched-for areas are blood sugar control, weight management, and diabetes.
Jak prawdopodobnie działa
Dulaglutide is presented as a receptor agonist. The supplied mechanism states that GLP-1 receptor activation supports insulin release when glucose is present, reduces glucagon, and slows gastric emptying. The molecule is described as a modified GLP-1 peptide attached to a human antibody Fc fragment; the source says this larger Fc-linked design reduces rapid renal clearance and helps protect the peptide from DPP-4 degradation. Appetite and modest weight-related effects are attributed in the source to GLP-1 signaling in hunger-regulating brain regions.
Co pokazują badania
Na jakim etapie są badania
The source characterizes Dulaglutide as supported by human clinical evidence rather than only animal work. It cites the AWARD program for glucose-lowering evidence across multiple type 2 diabetes contexts. It also highlights the 2019 Lancet REWIND trial, which followed more than 9,900 participants for a median period exceeding five years; about 69% reportedly had no previous cardiovascular disease. In that trial summary, major cardiovascular events were lower with dulaglutide than placebo, reported as 12.0% versus 13.4% with a hazard ratio of 0.88. The source notes gastrointestinal tolerability issues such as nausea and diarrhea and states that the class carries a boxed warning about thyroid C-cell tumors based on rodent findings.
Co pokazują
✓ Dane kliniczne u ludzi
Zatwierdzone zastosowania z ustalonymi danymi u ludzi
△ Ograniczenia
Stosowanie wyłącznie zgodnie z zatwierdzoną dokumentacją i pod opieką wykwalifikowanego specjalisty.
Podsumowanie: FDA Approved - Type 2 diabetes FDA Approved
Typowe dawkowanie
SpołecznośćZbiór danych społeczności1,5–4,5 mg
weekly
Community-reported dosing row; source also notes FDA-approved Trulicity labeling and a 0.75 mg titration context. This is not medical advice.
Dawkowanie badawcze
Zależne od wskazaniaZatwierdzony w określonych wskazaniach - dawki z badań zależą od wskazania
Timing i podanie
Najlepsza pora
Before bed or morning (fasted)
Follow specific peptide protocol
Zalecenia żywieniowe
Take on empty stomach
Dlaczego taki timing?
The supplied timing rationale refers to GH-related peptides and empty-stomach use for growth hormone release; this appears nonspecific to Dulaglutide and should be reviewed before use in a public profile.
Możliwe skutki uboczne
Nie każdy ich doświadcza. Indywidualne reakcje zależą od dawki, czasu trwania i czynników osobistych.
- Nausea
- Diarrhea
- Vomiting
- Abdominal pain
- Injection site reactions
- Hypoglycemia (with insulin/sulfonylureas)
- Pancreatitis
- Gallbladder problems
- BOXED WARNING: Thyroid C-cell tumors
- FDA approved (Trulicity)
Nie każdy doświadcza skutków ubocznych, a nasilenie może zależeć od kontekstu, czystości, drogi podania i indywidualnych czynników zdrowotnych.
Najczęstsze pytania
Sekwencja
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGSGGGGSGGGGSAESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG; Fc-linked dimer with KEGG-defined disulfides
Jeden otwarty zbiór danych
Każdy fakt na tej stronie - dawki, skutki uboczne, referencje - pochodzi z tego samego zbioru danych PeptiGuide, który zasila Tracker, Porównywarkę i Lab.
Przeglądaj zbiór danychMateriał edukacyjny, nie porada medyczna. Porozmawiaj z lekarzem, zanim podejmiesz działania.
Dyskusja społeczności
Komentarze są moderowane przed publikacją. Trzymajmy się dowodów.