pepti

Szukaj w PeptiGuide

Popularne wyszukiwania

Dulaglutide

Znany też jako: Trulicity

W skrócie

Zbiór danych PeptiGuide · przegląd sie 2026

Czym jest

Once-weekly GLP-1 receptor agonist listed as FDA approved for type 2 diabetes.

Status

Zatwierdzone przez FDA

Typowa dawka

1,5–4,5mg

Badany pod kątem

Blood sugar control, weight management, diabetes

Postęp badań

  1. PrePrzedkliniczne
  2. IFaza I
  3. IIFaza II
  4. IIIFaza III
  5. IVFaza IV
  6. FDAZatwierdzone przez FDA

Zatwierdzone przez FDA - Zatwierdzone zastosowania z ustalonymi danymi u ludzi

Bądź na bieżąco

Aktualizacje o Dulaglutide

Nowe badania, decyzje regulacyjne i korekty danych - gdy tylko się pojawią.

  • Dulaglutide, also called Trulicity, is described as a once-weekly injectable receptor agonist.
  • Source status fields list FDA Approved, with clinical status for type 2 diabetes.
  • The source also states FDA approval for cardiovascular risk reduction in adults with diabetes.
  • Reported typical dose is 1.5-4.5 mg weekly, with subcutaneous weekly administration and a 0.75-4.5 mg weekly range.
  • Source researched-for areas are blood sugar control, weight management, and diabetes.

Dulaglutide is presented as a receptor agonist. The supplied mechanism states that GLP-1 receptor activation supports insulin release when glucose is present, reduces glucagon, and slows gastric emptying. The molecule is described as a modified GLP-1 peptide attached to a human antibody Fc fragment; the source says this larger Fc-linked design reduces rapid renal clearance and helps protect the peptide from DPP-4 degradation. Appetite and modest weight-related effects are attributed in the source to GLP-1 signaling in hunger-regulating brain regions.

Na jakim etapie są badania

The source characterizes Dulaglutide as supported by human clinical evidence rather than only animal work. It cites the AWARD program for glucose-lowering evidence across multiple type 2 diabetes contexts. It also highlights the 2019 Lancet REWIND trial, which followed more than 9,900 participants for a median period exceeding five years; about 69% reportedly had no previous cardiovascular disease. In that trial summary, major cardiovascular events were lower with dulaglutide than placebo, reported as 12.0% versus 13.4% with a hazard ratio of 0.88. The source notes gastrointestinal tolerability issues such as nausea and diarrhea and states that the class carries a boxed warning about thyroid C-cell tumors based on rodent findings.

Co pokazują

Dane kliniczne u ludzi

Zatwierdzone zastosowania z ustalonymi danymi u ludzi

Ograniczenia

Stosowanie wyłącznie zgodnie z zatwierdzoną dokumentacją i pod opieką wykwalifikowanego specjalisty.

Podsumowanie: FDA Approved - Type 2 diabetes FDA Approved

Typowe dawkowanie

Społeczność

1,5–4,5 mg

weekly

0,75 mg4,5 mg

Community-reported dosing row; source also notes FDA-approved Trulicity labeling and a 0.75 mg titration context. This is not medical advice.

Dawkowanie badawcze

Zależne od wskazania

Dawki obserwowane w badaniach

0.75mg weekly (starting)

FDA Approved Labeling - Prescribed dose

Stosowanie wyłącznie zgodnie z zatwierdzoną dokumentacją i pod opieką wykwalifikowanego specjalisty.

Czas trwania
Long-term / chronic use
Podanie
Subcutaneous injection weekly

Najlepsza pora

Before bed or morning (fasted)

Follow specific peptide protocol

Zalecenia żywieniowe

Take on empty stomach

Dlaczego taki timing?

The supplied timing rationale refers to GH-related peptides and empty-stomach use for growth hormone release; this appears nonspecific to Dulaglutide and should be reviewed before use in a public profile.

Nie każdy ich doświadcza. Indywidualne reakcje zależą od dawki, czasu trwania i czynników osobistych.

  • Nausea
  • Diarrhea
  • Vomiting
  • Abdominal pain
  • Injection site reactions
  • Hypoglycemia (with insulin/sulfonylureas)
  • Pancreatitis
  • Gallbladder problems
  • BOXED WARNING: Thyroid C-cell tumors
  • FDA approved (Trulicity)

Nie każdy doświadcza skutków ubocznych, a nasilenie może zależeć od kontekstu, czystości, drogi podania i indywidualnych czynników zdrowotnych.

HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGSGGGGSGGGGSAESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG; Fc-linked dimer with KEGG-defined disulfides

Jeden otwarty zbiór danych

Każdy fakt na tej stronie - dawki, skutki uboczne, referencje - pochodzi z tego samego zbioru danych PeptiGuide, który zasila Tracker, Porównywarkę i Lab.

Przeglądaj zbiór danych

Materiał edukacyjny, nie porada medyczna. Porozmawiaj z lekarzem, zanim podejmiesz działania.

Dyskusja społeczności

Komentarze są moderowane przed publikacją. Trzymajmy się dowodów.