What does Dulaglutide do?

Dulaglutide, also known by the brand name Trulicity, is described as a once-weekly injectable GLP-1 receptor agonist. The source states it is FDA approved for type 2 diabetes and for reducing cardiovascular risk in adults with diabetes.

Is Dulaglutide FDA approved?

Yes. The source lists Dulaglutide as FDA Approved, with clinical status noted as FDA Approved - Type 2 diabetes.

What side effects are reported for Dulaglutide?

The source lists nausea, diarrhea, vomiting, abdominal pain, injection site reactions, hypoglycemia with insulin or sulfonylureas, pancreatitis, gallbladder problems, and a boxed warning for thyroid C-cell tumors. It also includes FDA approved (Trulicity) in the same side-effects array, which appears to be a regulatory note rather than an adverse effect.

What typical dose does the source report for Dulaglutide?

The source reports a community common dose of 1.5-4.5 mg weekly, a range of 0.75-4.5 mg weekly, and once-weekly subcutaneous administration. A research row lists 0.75mg weekly (starting) under FDA Approved Labeling. These are source-reported values for review, not personalized dosing guidance.

Weight Loss FDA Approved - approved for specific uses

Dulaglutide

Also known as: Trulicity

At a glance

PeptiGuide dataset · reviewed Aug 2026

What it is

Once-weekly GLP-1 receptor agonist listed as FDA approved for type 2 diabetes.

Status

FDA Approved

Evidence level: human clinical evidence

Typical dose

1.5–4.5mg

Subcutaneous injection weekly

Researched for

Blood sugar control, weight management, diabetes

Trial progress

PrePreclinical
IPhase I
IIPhase II
IIIPhase III
IVPhase IV
FDAFDA approved

FDA approved - FDA-approved for specific uses with established human evidence

Use the tools

In plain language

Dulaglutide, also called Trulicity, is described as a once-weekly injectable receptor .
Source status fields list FDA Approved, with clinical status for type 2 diabetes.
The source also states FDA approval for cardiovascular risk reduction in adults with diabetes.
Reported typical dose is 1.5-4.5 mg weekly, with weekly administration and a 0.75-4.5 mg weekly range.
Source researched-for areas are blood sugar control, weight management, and diabetes.

How it's thought to work

Dulaglutide is presented as a receptor . The supplied mechanism states that GLP-1 receptor activation supports insulin release when glucose is present, reduces glucagon, and slows gastric emptying. The molecule is described as a modified GLP-1 peptide attached to a human antibody Fc fragment; the source says this larger Fc-linked design reduces rapid renal clearance and helps protect the peptide from DPP-4 degradation. Appetite and modest weight-related effects are attributed in the source to GLP-1 signaling in hunger-regulating brain regions.

What the research shows

Where the research stands

The source characterizes Dulaglutide as supported by human clinical evidence rather than only animal work. It cites the AWARD program for glucose-lowering evidence across multiple type 2 diabetes contexts. It also highlights the 2019 Lancet REWIND trial, which followed more than 9,900 participants for a median period exceeding five years; about 69% reportedly had no previous cardiovascular disease. In that trial summary, major cardiovascular events were lower with dulaglutide than placebo, reported as 12.0% versus 13.4% with a hazard ratio of 0.88. The source notes gastrointestinal tolerability issues such as nausea and diarrhea and states that the class carries a boxed warning about thyroid C-cell tumors based on rodent findings.

What it shows

✓ Human clinical evidence

FDA-approved for specific uses with established human evidence

△ Limitations

Use only according to approved labeling and qualified medical guidance.

Bottom line: FDA Approved - Type 2 diabetes FDA Approved

Typical dosing

CommunityCommunity dataset

1.5–4.5 mg

weekly

0.75 mgfull range seen4.5 mg

Community-reported dosing row; source also notes FDA-approved Trulicity labeling and a 0.75 mg titration context. This is not medical advice.

Research dosing

Indication-specificApproved for specific uses - study doses are indication-specific

Doses observed in studies

0.75mg weekly (starting)

FDA Approved Labeling - Prescribed dose

Use only according to approved labeling and qualified medical guidance.

Duration: Long-term / chronic use
Administration: Subcutaneous injection weekly

Timing & administration

Best time to take

Before bed or morning (fasted)

Follow specific peptide protocol

Food recommendation

Take on empty stomach

Why this timing?

The supplied timing rationale refers to GH-related peptides and empty-stomach use for growth hormone release; this appears nonspecific to Dulaglutide and should be reviewed before use in a public profile.

Possible side effects

Not everyone experiences these. Individual responses vary with dose, duration, and personal factors.

Nausea
Diarrhea
Vomiting
Abdominal pain
Injection site reactions
Hypoglycemia (with insulin/sulfonylureas)
Pancreatitis
Gallbladder problems
BOXED WARNING: Thyroid C-cell tumors
FDA approved (Trulicity)

Not everyone experiences side effects, and severity can vary by context, purity, route, and individual health factors.

Sources

PubMed ClinicalTrials.gov FDA.gov

Frequently asked questions

The source describes Dulaglutide as activating GLP-1 receptors. Reported downstream effects include glucose-dependent insulin release, lower glucagon signaling, delayed gastric emptying, and appetite-related signaling in brain regions involved in hunger. Its modified GLP-1 peptide is fused to a human antibody Fc fragment, which the source says helps avoid rapid kidney clearance and protects against DPP-4 breakdown.

Sequence

HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGSGGGGSGGGGSAESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG; Fc-linked dimer with KEGG-defined disulfides

One open dataset

Every fact on this page - doses, side effects, references - comes from the same PeptiGuide dataset that powers the Tracker, Compare, and the Lab.

Browse the dataset

Save to my research list Get updates on Dulaglutide

Educational resource, not medical advice. Talk to your clinician before acting on anything here.

Community discussion

Comments are moderated before they appear. Keep it evidence-focused.

Dulaglutide

In plain languageIn plain language

How it's thought to workHow it's thought to work

What the research showsWhat the research shows

Typical dosing

Research dosing

Timing & administrationTiming & administration

Possible side effectsPossible side effects

SourcesSources

Frequently asked questionsFrequently asked questions